Recombinant Human Retinol-binding protein 3/RBP3 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP03269-10, RP03269-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Retinol-binding protein 3/RBP3 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Thr321-Leu630) of human RBP3 (Accession #P10745) fused with His tag at the N-terminus.
Alternate Names: Retinol-binding protein 3; Interphotoreceptor retinoid-binding protein; Interstitial retinol-binding protein; RBP3; IRBP
SWISS: P10745
GeneID: 5949
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Retinol-binding proteins (RBP) are carrier proteins that bind retinol. Retinol and retinoic acid play crucial roles in the modulation of gene expression and overall development of an embryo. However, deficit or excess of either one of these substances can cause early embryo mortality or developmental malformations. Regulation of transport and metabolism of retinol necessary for a successful pregnancy is accomplished via RBP. Retinol binding proteins have been identified within the uterus, embryo, and extraembryonic tissue of the bovine, ovine, and porcine, clearly indicating that RBP plays a role in proper retinol exposure to the embryo and successful transport at the maternal-fetal interface.
Source: E.coli
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: TLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEAIRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVL
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only