WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Retinol-binding protein 3/RBP3 Protein - RP03269

Recombinant Human Retinol-binding protein 3/RBP3 Protein - RP03269

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Retinol-binding protein 3/RBP3 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP03269-10, RP03269-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Retinol-binding protein 3/RBP3 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Thr321-Leu630) of human RBP3 (Accession #P10745) fused with His tag at the N-terminus.

Alternate Names: Retinol-binding protein 3; Interphotoreceptor retinoid-binding protein; Interstitial retinol-binding protein; RBP3; IRBP

SWISS: P10745

GeneID: 5949

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Retinol-binding proteins (RBP) are carrier proteins that bind retinol. Retinol and retinoic acid play crucial roles in the modulation of gene expression and overall development of an embryo. However, deficit or excess of either one of these substances can cause early embryo mortality or developmental malformations. Regulation of transport and metabolism of retinol necessary for a successful pregnancy is accomplished via RBP. Retinol binding proteins have been identified within the uterus, embryo, and extraembryonic tissue of the bovine, ovine, and porcine, clearly indicating that RBP plays a role in proper retinol exposure to the embryo and successful transport at the maternal-fetal interface.

Source: E.coli

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: TLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEAIRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVL

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only