Skip to product information
1 of 1

ABclonal

Recombinant Human Retinol-binding protein 4/PRBP Protein - RP00274

Recombinant Human Retinol-binding protein 4/PRBP Protein - RP00274

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Retinol-binding protein 4/PRBP Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00274-10, RP00274-20, RP00274-50, RP00274-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Retinol-binding protein 4/PRBP Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu19-Leu201) of human RBP4 (Accession #NP_006735.2) fused with a 6×His tag at the C-terminus.

Alternate Names: MCOPCB10, RDCCAS, RBP4, RDCCAS

SWISS: P02753

GeneID: 5950

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human RBP4 Protein at 2 μg/mL (100 μL/well) can bind RBP4 Rabbit mAb with a linear range of 0.12-2.4 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details