Recombinant Human Retinol-binding protein 4/PRBP Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00284-10, RP00284-20, RP00284-50, RP00284-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Retinol-binding protein 4/PRBP Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu19-Leu201) of human RBP4 (Accession #NP_006735.2) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: MCOPCB10, RDCCAS, RBP4, RDCCAS
SWISS: P02753
GeneID: 5950
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human RBP4 Protein at 2 μg/mL (100 μL/well) can bind RBP4 Rabbit mAb with a linear range of 0.12-2.1 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only