Recombinant Human RETN Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01810-10, RP01810-20, RP01810-50, RP01810-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human RETN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser17-Pro108) of human RETN (Accession #) fused with a hFc, 6×His tag at the N-terminus.
Alternate Names: ADSF; RENT; RSTN; XCP1; FIZZ3; RETN1
SWISS: Q9HD89
GeneID: 56729
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Resistin is an adipocytokine, which has been studied for its role in insulin resistance and recently in inflammation. The RETN and CAP1 polymorphisms and gene expression may be potential biomarkers for breast cancer risk. Resistin (RETN), recently found to be relevant to inflammation and inflammatory disorders.
Source: HEK293 cells
Tag: N-hFc-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only