ABclonal
Recombinant Human ROR1 Protein - RP01208
Recombinant Human ROR1 Protein - RP01208
Couldn't load pickup availability
Recombinant Human ROR1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01208-10, RP01208-20, RP01208-50, RP01208-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human ROR1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln30-Glu403) of human ROR1 (Accession #NP_005003.2) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: ROR1, NTRKR1, dJ537F10.1
SWISS: Q01973
GeneID: 4919
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human ROR1 Protein at 1μg/mL (100 μL/well) can bind ROR1 Rabbit pAb with a linear range of 0.977-5.7 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
