Skip to product information
1 of 1

ABclonal

Recombinant Human ROR1 Protein - RP01208

Recombinant Human ROR1 Protein - RP01208

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human ROR1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01208-10, RP01208-20, RP01208-50, RP01208-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human ROR1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln30-Glu403) of human ROR1 (Accession #NP_005003.2) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: ROR1, NTRKR1, dJ537F10.1

SWISS: Q01973

GeneID: 4919

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human ROR1 Protein at 1μg/mL (100 μL/well) can bind ROR1 Rabbit pAb with a linear range of 0.977-5.7 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details