ABclonal
Recombinant Human S100-A10 Protein - RP01677LQ
Recombinant Human S100-A10 Protein - RP01677LQ
Couldn't load pickup availability
Recombinant Human S100-A10 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01677LQ-10, RP01677LQ-20, RP01677LQ-50, RP01677LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human S100-A10 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Lys97) of human S100A10 (Accession #NP_002957.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: 42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG; S100A10
SWISS: P60903
GeneID: 6281
Species: Human
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: S100A10 functions as a linker tethering certain transmembrane proteins to annexin A2 thereby assisting their traffic to the plasma membrane and/or their firm anchorage at certain membrane sites.
Source: E. coli
Tag: C-6His
Formulation: Supplied as a 0.22 μm filtered solution in 20mM Tris 10% Glycerol, PH8.5
Antigen Sequence: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
