ABclonal
Recombinant Human S100-A12 Protein - RP00009
Recombinant Human S100-A12 Protein - RP00009
Couldn't load pickup availability
Recombinant Human S100-A12 Protein
Sizes: 50ug, 100ug
Catalogue Number: RP00009-50, RP00009-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human S100-A12 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu92) of human S100A12 (Accession #NP_005612.1) fused with a 6×His tag at the C-terminus.
Alternate Names: S100A12, CAAF1, CAGC, CGRP, ENRAGE, MRP-6, MRP6, p6
SWISS: P80511
GeneID: 6283
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 proteins include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human S100A12 Protein at 2 μg/mL (100 μL/well) can bind AGER with a linear range of 1.95-14.13 ng/mL.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
