Recombinant Human S100-A4 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01564-10, RP01564-20, RP01564-50, RP01564-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human S100-A4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Lys101) of human S100-A4 (Accession #NP_002952.1) fused with no additional amino acid.
Alternate Names: 18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98, S100A4, 18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98, protein S100-A4
SWISS: P26447
GeneID: 6275
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: S100A4 belongs to the family of small calcium-binding S100 proteins containing two EF-hand calcium-binding motifs. In humans at least 20 S100 family members that are distributed tissue specifically have been identified, and are involved in a number of cellular processes as transducers of calcium signal. S100A4 is a symmetric homodimer, and undergoes a relatively large conformational change upon the typical EF-hand binding calcium, which is necessary for S100A4 to interact with its protein targets and generate biological effects. It can bind the already known targets p53, F-actin, liprin β, myosin heavy chain II, and prevent their phosphorylation and multimerization. It has been demonstrated that S100A4 is directly involved in tumor metastasis including cell motility, invasion, apoptosis, angiogenesis and differentiation, and appears to be a metastasis factor and a molecular marker for clinical prognosis. Multiple alternatively spliced variants encoding the same protein have been identified.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only