ABclonal
Recombinant Human S100-A7 Protein - RP01795
Recombinant Human S100-A7 Protein - RP01795
Couldn't load pickup availability
Recombinant Human S100-A7 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01795-10, RP01795-20, RP01795-50, RP01795-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human S100-A7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2-Gln101) of human S100-A7 (Accession #NP_002954.2) fused with a hFc tag at the C-terminus.
Alternate Names: PSOR1; S100A7c; S100-A7; S100A7
SWISS: P31151
GeneID: 6278
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Protein S100-A7, also known as S100 calcium-binding protein A7, Psoriasin, S100A7, and PSOR1, is a secreted protein which belongs to theS-100 family. S100A7 was first isolated from skin involved by psoriasis, which can be induced in cultured squamous epithelial cells. S100A7 is expressed by both normal cultured and malignant keratinocytes and malignant breast epithelial cells within ductal carcinoma in situ, suggesting an association with abnormal pathways of differentiation. S100A7 plays a role in the pathogenesis of inflammatory skin disease, as a chemotactic factor for hematopoietic cells. It also plays a role in early stages of breast tumor progression in association with the development of the invasive phenotype.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
