Recombinant Human S100-A9 Protein
Sizes: 10ug, 50ug, 100ug
Catalogue Numbers: RP01269-10, RP01269-50, RP01269-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human S100-A9 Protein is produced by Baculovirus-Infected Sf9 Cells expression system. The target protein is expressed with sequence (Met1-Pro114) of human S100A9 (Accession #NP_002956.1) fused with a 6×His tag at the C-terminus.
Alternate Names: MIF, NIF, P14, CAGB, CFAG, CGLB, L1AG, LIAG, MRP14, 60B8AG, MAC387, S100-A9, S100A9, 60B8AG, CAGB, CFAG, CGLB, L1AG, LIAG, MAC387, MRP14, NIF, P14
SWISS: P06702
GeneID: 6280
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human S100A9 Protein at 2 μg/mL (100 μL/well) can bind AGER with a linear range of 0.124-41.19 ng/mL.
Source: Baculovirus-Infected Sf9 Cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS,1mM DTT, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only