WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human S100-B Protein - RP00699

Recombinant Human S100-B Protein - RP00699

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human S100-B Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00699-10, RP00699-20, RP00699-50, RP00699-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human S100-B Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu92) of human S100 Calcium Binding Protein B/S100B (Accession #P04271) fused with an initial Met at the N-terminus and a 6×His tag at the N-terminus.

Alternate Names: NEF, S100, S100-B, S100beta, S100B, S100 beta

SWISS: P04271

GeneID: 6285

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: S100-B, is an acidic protein with a molecular weight of 21 kDa belonging to the S100 family. S100-B containstwo EF-hand-type calcium-binding motifs separated by a hinge region with a hydrophobic cleft. S100-B playsan important role in neurodevelopment, differentiation, and brain construction. S100-B has neuroprotectiveeffects, but at high concentrations S100-B is neurotoxic. Extracellular concentration of S100-B increasesfollowing brain damage, which easily penetrates into cerebrospinal fluid in brain damage and then into theblood. S100-B is expressed and produced by astrocytes in vertebrate brains and in the CNS, and the astrocytesare the major cells producing S100-B protein in gray matter, as well as oligodendrocytes are the predominantS100-B in protein producing cells in white matter. The major advantage of using S100-B is that elevations inserum or CSF levels provide a sensitive measure for determining CNS injury at the molecular level before grosschanges develop, enabling timely delivery of crucial medical intervention before irreversible damage occurs. Inaddition, S100-B, which is also present in human melanocytes, is a reliable marker for melanoma malignancyboth in bioptic tissue and in serum.

Source: HEK293 cells

Tag: N-hFc&Avi

Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PBS,150mM NaCl,pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only