Recombinant Human Sclerostin/SOST Protein - RP01169

Recombinant Human Sclerostin/SOST Protein

Sizes: 10ug, 20ug

Catalogue Number: RP01169-10, RP01169-20

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Sclerostin/SOST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Tyr213) of human SOST/Sclerostin (Accession #NP_079513.1) fused with a 8×His tag at the N-terminus.

Alternate Names: SOST, CDD, DAND6, SOST1, VBCH

SWISS: Q9BQB4

GeneID: 50964

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only