Recombinant human SECTM1 Protein - RP01731

Recombinant human SECTM1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01731-10, RP01731-20, RP01731-50, RP01731-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant human SECTM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln29-Gly145) of human SECTM1 (Accession #NP_002995.1.) fused with and a 6×His tag at the C-terminus.

Alternate Names: K12; SECTM; SECTM1

SWISS: Q8WVN6

GeneID: 6398

Species: human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Secreted and transmembrane 1 (SECTM1), also known as K12, is a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein of SECTM family. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only