Skip to product information
1 of 1

ABclonal

Recombinant Human Serpin B3/SCCA-1 Protein - RP01110

Recombinant Human Serpin B3/SCCA-1 Protein - RP01110

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Serpin B3/SCCA-1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01110-10, RP01110-20, RP01110-50, RP01110-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Serpin B3/SCCA-1 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Met1-Pro390) of human Serpin B3 (Accession #P29508) fused with a 6×His tag at the C-terminus.

Alternate Names: SERPINB3, HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, SSCA1, T4-A, serpin B3, SerpinB3, HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, SSCA1, T4-A, serpin B3

SWISS: P29508

GeneID: 6317

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Serpin B3, also known as squamous cell carcinoma antigen-1 (SCCA-1), is a member of the serpin superfamily of serine protease inhibitors. Serpin B3 belongs to the subgroup ovalbumin-related serpins which are involved in the regulation of apoptosis, inflammation, angiogenesis and embryogenesis. It may act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. It also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details