Skip to product information
1 of 1

ABclonal

Recombinant Human Serpin F1/PEDF Protein - RP00013

Recombinant Human Serpin F1/PEDF Protein - RP00013

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Serpin F1/PEDF Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP00013-20, RP00013-50, RP00013-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Serpin F1/PEDF Protein is produced by insect cell-baculovirus expression system. The target protein is expressed with sequence (Gln20-Pro418) of human Serpin F1 (Accession #NP_002606.3).

Alternate Names: EPC-1, OI12, OI6, PEDF, PIG35, SERPINF1, OI12, OI6, PEDF, PIG35

SWISS: P36955

GeneID: 5176

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein is a member of the serpin family, although it does not display the serine protease inhibitory activity shown by many of the other serpin family members. The encoded protein is secreted and strongly inhibits angiogenesis. In addition, this protein is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells.

Source: Baculovirus-Infected Sf9 Cells

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details