ABclonal
Recombinant Human Serpin F1/PEDF Protein - RP00013
Recombinant Human Serpin F1/PEDF Protein - RP00013
Couldn't load pickup availability
Recombinant Human Serpin F1/PEDF Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP00013-20, RP00013-50, RP00013-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Serpin F1/PEDF Protein is produced by insect cell-baculovirus expression system. The target protein is expressed with sequence (Gln20-Pro418) of human Serpin F1 (Accession #NP_002606.3).
Alternate Names: EPC-1, OI12, OI6, PEDF, PIG35, SERPINF1, OI12, OI6, PEDF, PIG35
SWISS: P36955
GeneID: 5176
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein is a member of the serpin family, although it does not display the serine protease inhibitory activity shown by many of the other serpin family members. The encoded protein is secreted and strongly inhibits angiogenesis. In addition, this protein is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells.
Source: Baculovirus-Infected Sf9 Cells
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
