ABclonal
Recombinant Human Serum amyloid A-1/SAA1 Protein - RP01095
Recombinant Human Serum amyloid A-1/SAA1 Protein - RP01095
Regular price
$210.00 CAD
Regular price
Sale price
$210.00 CAD
Quantity
Couldn't load pickup availability
Recombinant Human Serum amyloid A-1/SAA1 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP01095-10, RP01095-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Serum amyloid A-1/SAA1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg19-Tyr122) of human SAA1 (Accession #P0DJI8) fused with a 6×His tag at the N-terminus.
Alternate Names: SAA1, PIG4, SAA, SAA2, TP53I4
SWISS: P0DJI8
GeneID: 6288
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer' s disease and Crohn' s disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11.
Source: E. coli
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM EDTA, pH 8.0.Contact us for customized product form or formulation.
Antigen Sequence: RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
View full details
