Recombinant Human Siglec-15/CD33L3 Protein
Sizes: 10ug, 20ug, 100ug
Catalogue Numbers: RP01187-10, RP01187-20, RP01187-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Thr263) of human Siglec-15/CD33L3 (Accession #NP_998767.1) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: CD33L3, HsT1361, SIGLEC-15, SIGLEC15, Siglec-15
SWISS: Q6ZMC9
GeneID: 284266
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its ability to inhibit Anti-CD3-induced proliferation of jurkat cells. The ED50 for this effect is 1.8-7.2 μg/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS,300mM NaCl, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only