Skip to product information
1 of 1

ABclonal

Recombinant Human Siglec-15/CD33L3 Protein - RP01256

Recombinant Human Siglec-15/CD33L3 Protein - RP01256

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Siglec-15/CD33L3 Protein

Sizes: 10ug, 50ug, 100ug

Catalogue Numbers: RP01256-10, RP01256-50, RP01256-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Thr263) of human Siglec-15/CD33L3 (Accession #NP_998767.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CD33L3, HsT1361, SIGLEC-15, SIGLEC15, Siglec-15

SWISS: Q6ZMC9

GeneID: 284266

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its ability to inhibit Anti-CD3-induced proliferation of jurkat cells. The ED50 for this effect is 4.99-19.98 μg/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS,300mM NaCl, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details