Recombinant Human Siglec-3/CD33 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00159-10, RP00159-20, RP00159-50, RP00159-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Siglec-3/CD33 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp18-His259) of human CD33/Siglec-3 (Accession #NP_001763.3) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: CD33, SIGLEC-3, SIGLEC3, p67, CD33 molecule, SIGLEC-3, SIGLEC3, p67
SWISS: P20138
GeneID: 945
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Myeloid cell surface antigen CD33 also known as Sialic acid binding Ig-like lectin 3, CD33 antigen or Siglec-3, is a member of the immunoglobulin superfamily and SIGLEC (sialic acid binding Ig-like lectin) family. This Single-pass type I membrane protein contains 1 Ig-like C2-type (immunoglobulin-like) domain and 1 Ig-like V-type (immunoglobulin-like) domain. CD33/Siglec-3 induces apoptosis in acute myeloid leukemia (in vitro). CD33/Siglec-3 can function as a sialic acid-dependent cell adhesion molecule and that binding can be modulated by endogenous sialoglycoconjugates when CD33 is expressed in a plasma membrane.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD33 Protein at 1μg/mL (100 μL/well) can bind CD33 Rabbit pAb with a linear range of 0.03-1.66 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only