ABclonal
Recombinant Human SLAMF2/CD48 Protein - RP00107
Recombinant Human SLAMF2/CD48 Protein - RP00107
Couldn't load pickup availability
Recombinant Human SLAMF2/CD48 Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP00107-20, RP00107-50, RP00107-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human SLAMF2/CD48 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln27-Ser220) of human CD48/SLAMF2/BCM1 (Accession #NP_001769.2) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48, CD48, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48
SWISS: P09326
GeneID: 962
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant human CD244 at 5 μg/mL (100 μL/well) can bind Recombinant human CD48 with a linear range of 0.15-0.65 μg/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
