WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human SLAMF5/CD84 Protein - RP02164

Recombinant Human SLAMF5/CD84 Protein - RP02164

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human SLAMF5/CD84 Protein

Sizes: 10ug, 20ug, 100ug

Catalogue Numbers: RP02164-10, RP02164-20, RP02164-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human SLAMF5/CD84 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Lys22-Arg220) of human SLAMF5 (Accession #Q9UIB8) fused with a 6xHis tag at the C- terminus.

Alternate Names: CD84, LY9B, SLAMF5, hCD84, mCD84, CD84 molecule, LY9B, SLAMF5, hCD84, mCD84

SWISS: Q9UIB8

GeneID: 8832

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: SLAM family member 5 (SLAMF5/CD84) is a type I transmembrane protein in the SLAM subgroup of the CD2 family. SLAM family proteins regulate multiple aspects of immune system function. Mature human CD84 consists of a 204 amino acid (aa) extracellular domain (ECD) with two Iglike domains,a 21 aa transmembrane segment, and a 99 aa cytoplasmic domain with two immunoreceptor tyrosinebased switch motifs (ITSMs). CD84 exhibits homophilic binding which is mediated by the N-terminal Ig-like domain. Ligation induces tyrosine phosphorylation in the cytoplasmic ITSMs which then recruit the signaling adaptor molecules SAP (SLAM-associated protein) and EAT-2(EWS/Fli1-activated transcript 2).CD84 signaling inhibits Fc epsilon RI-induced mast cell activation but enhances platelet activation. LPS-induced macrophage activation,T cell proliferation and IFN-γproduction, and the interactions between T cells and B cells that are required for germinal center formation.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFR

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only