Skip to product information
1 of 1

ABclonal

Recombinant Human SLAMF6/NTB-A/CD352 Protein - RP01959

Recombinant Human SLAMF6/NTB-A/CD352 Protein - RP01959

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human SLAMF6/NTB-A/CD352 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01959-10, RP01959-20, RP01959-50, RP01959-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human SLAMF6/NTB-A/CD352 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Met226) of Human SLAMF6/NTB-A/CD352 (Accession #NP_001171643.1) fused with a hFc tag at the C-terminus.

Alternate Names: SLAMF6, KALI, UNQ6123/PRO20080, SLAM family member 6, Activating NK receptor, NK-T-B-antigen, NTB-A, CD352

SWISS: Q96DU3-1

GeneID: 114836

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: SLAM Family Member 6 (SLAMF6) is a 60 kD single-pass type I membrane protein that belongs to the SLAM subgroup of the CD2 family. Human SLAMF6/ NTB-A contains a 205 amino acid extracellular domain (ECD) with one Ig-like V-set and one Ig-like C2-set domain, a 21 amino acid transmembrane segment and an 84 amino acid cytoplasmic domain, with two immunoreceptor tyrosine-based switch motifs. SLAMF6 is a homodimer. SLAMF6 can interact with PTN6 and, upon phosphorylation, with PTN11 and SH2D1A/SAP. Phosphorylation-dependent NTB-A association with SAP is required for full production of IFN- γ by NK cells and independent of EAT-2 binding. It Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors. On B cells, NTB-A modulates immunoglobulin class switching and the balance between tolerance and autoimmunity.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details