Recombinant Human SLAMF7/CRACC/CD319 Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP00292-20, RP00292-50, RP00292-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human SLAMF7/CRACC/CD319 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser23-Met226) of human SLAMF7/CD319 (Accession #NP_067004.3) fused with a 6×His tag at the C-terminus.
Alternate Names: SLAMF7, 19A, CD319, CRACC, CS1
SWISS: Q9NQ25
GeneID: 57823
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: SLAM family member 7 (SLAMF7), also known as CRACC, CD319, CD2-like receptor-activating cytotoxic cells, and CS1, is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. SLAMF7 is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells but not in promyelocytic, B-cell lines, or T-cell lines. In human NK cells, activated SLAMF7 transmits signals following association with the adaptor protein EAT-2. In the absence of EAT-2, SLAMF7 potently inhibited natural killer cell function. It was also inhibitory in T cells, which are typically devoid of EAT-2. Thus, SLAMF7 can exert activating or inhibitory influences on cells of the immune system depending on cellular context and the availability of effector proteins.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human SLAMF7 at 2 μg/mL (100 μL/well) can bind Anti-SLAMF7 antibody with a linear range of 40-120 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only