Recombinant Human Sonic hedgehog protein N-product/SHH(C24IVI) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00056-10, RP00056-20, RP00056-50, RP00056-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Sonic hedgehog protein N-product/SHH(C24IVI) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys24-Gly197 (Cys24Ile-Val-Ile)) of human Sonic hedgehog N-product (Accession #NP_000184.1).
Alternate Names: HHG1, HLP3, HPE3, MCOPCB5, SMMCI, TPT, TPTPS, SHH, HHG1, sonic hedgehog, HLP3, HPE3, MCOPCB5, SMMCI, TPT, TPTPS
SWISS: Q15465
GeneID: 6469
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. It is also thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.
Bio-Activity: Measured by its ability to inhibit p53 expression in C3H10T1/2 mouse embryonic fibroblast cells. 1.25-2.5 μg/mL of Recombinant Human Sonic hedgehog can effectively decrease p53 expression.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 300mM NaCl, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only