ABclonal
Recombinant Human TACTILE/CD96 Protein - RP00942
Recombinant Human TACTILE/CD96 Protein - RP00942
Couldn't load pickup availability
Recombinant Human TACTILE/CD96 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00942-10, RP00942-20, RP00942-50, RP00942-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TACTILE/CD96 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Val22-Met503) of human CD96 (Accession #P40200-2) fused with a 6×His tag at the C-terminus.
Alternate Names: TACTILE, CD96
SWISS: P40200-2
GeneID: 10225
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: VWEKTVNTEENVYATLGSDVNLTCQTQTVGFFVQMQWSKVTNKIDLIAVYHPQYGFYCAYGRPCESLVTFTETPENGSKWTLHLRNMSCSVSGRYECMLVLYPEGIQTKIYNLLIQTHVTADEWNSNHTIEIEINQTLEIPCFQNSSSKISSEFTYAWSVEDNGTQETLISQNHLISNSTLLKDRVKLGTDYRLHLSPVQIFDDGRKFSCHIRVGPNKILRSSTTVKVFAKPEIPVIVENNSTDVLVERRFTCLL
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
