ABclonal
Recombinant Human Tenascin C/TNC Protein - RP02798
Recombinant Human Tenascin C/TNC Protein - RP02798
Couldn't load pickup availability
Recombinant Human Tenascin C/TNC Protein
Sizes: 50ug, 100ug
Catalogue Number: RP02798-50, RP02798-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Tenascin C/TNC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly23-Ser621) of Human Tenascin C/TNC(Accession #NP_002151.2) fused with a His tag at the C-terminus.
Alternate Names: TNC, HXB, Tenascin, TN, Cytotactin, GMEM, GP 150-225, Glioma-associated-extracellular matrix antigen, Hexabrachion, JI, Myotendinous antigen, Neuronectin, Tenascin-C, TN-C
SWISS: P24821
GeneID: 3371
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Tenascin C/TNC is a member of the Tenascin family of extracellular matrix proteins. It is secreted as a disulfide-linked homohexamer whose subunits can vary in size from approximately 200 kDa to over 300 kDa due to differences in glycosylation. Hman Tenascin C monomer is synthesized as a precursor with a 22 amino acid (aa) signal sequence and a 2179 aa mature chai). Mature human Tenascin C (isoform 1) shares 84% aa sequence identity with mature mouse Tenascin C. In the developing embryo, Tenascin C is expressed during neural, skeletal, and vascular morphogenesis. In the adult, it virtually disappears with continued basal expression detectable only in tendon-associated tissues. However, greatup-regulation in expression occurs in tissues undergoing remodeling processes seen during wound repair and neovascularization or in pathological states such as inflammation or tumorigenesis.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCS
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
