Recombinant Human Testican-1/SPOCK1 Protein - RP01051

Recombinant Human Testican-1/SPOCK1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01051-10, RP01051-20, RP01051-50, RP01051-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Testican-1/SPOCK1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg22-Trp439) of human Testican 1/SPOCK1 (Accession #NP_004589.1. ) fused with a 6×His tag at the C-terminus.

Alternate Names: SPOCK, TIC1, TICN1, Testican-1, SPOCK1

SWISS: Q08629

GeneID: 6695

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its ability to inhibit active Cathepsin L cleavage of a fluorogenic peptide substrate Z-LR-AMC. The IC50 value approximately is 1.7 nM.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: RHLDALAGGAGPNHGNFLDNDQWLSTVSQYDRDKYWNRFRDDDYFRNWNPNKPFDQALDP SKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCPV AQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDK ELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGRFDTSILPICKDSLGWMFNKLDMNYD LLLDPSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQ KLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNELAGSRKQGAVSCEEEQE TSGDFGSGGSVVLLDDLEYERELGPKDKEGKLRVHTRAVTEDDEDEDDDKEDEVGYIW

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only