Recombinant Human Tetranectin/CLEC3B Protein - RP00991

Recombinant Human Tetranectin/CLEC3B Protein

Sizes: 10ug, 50ug, 100ug

Catalogue Numbers: RP00991-10, RP00991-50, RP00991-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Tetranectin/CLEC3B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu22-Val202) of human Tetranectin (Accession #NP_003269.2) fused with a 6×His tag at the C-terminus.

Alternate Names: CLEC3B, TN, TNA, TNA

SWISS: P05452

GeneID: 7123

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized human HGF (Catalog: RP01602) at 5 μg/mL(100 μL/well) can bind human CLEC3B with a linear range of 0.05-5.91 μg/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only