Recombinant Human TGF-alpha Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01780-10, RP01780-20, RP01780-50, RP01780-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TGF-alpha Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val40-Ala89) of human TGF-alpha/TGFA (Accession #NP_003227.1) fused with no tag.
Alternate Names: TFGA; TGF-alpha
SWISS: P01135-1
GeneID: 7039
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The miR-137 served as a tumor suppressor in non-small cell lung cancer (NSCLC) and its suppressive effect is mediated by repressing TGFA expression. TGFA gene expression was significantly higher in tumor tissues compared to adjacent normal tissue and high TGFA gene expression strongly correlated with poor survival in patients with lung adenocarcinoma, and miR-374a suppresses lung adenocarcinoma cell proliferation and invasion via targeting TGFA gene expression. Transforming growth factor alpha (TGFA) is a well-characterized mammalian growth factor that might contribute to the development of Cleft lip and palate (CL/P).
Source: E. coli
Tag: No-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 100mM NaCl, pH8.0
Antigen Sequence: VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only