Recombinant Human TGF-beta receptor type-2/TGFR-2 Protein - RP00239

Recombinant Human TGF-beta receptor type-2/TGFR-2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00239-10, RP00239-20, RP00239-50, RP00239-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TGF-beta receptor type-2/TGFR-2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr23-Asp159) of human TGFBR2 (Accession #NP_003233.4) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: AAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TGFR-2, TGFbeta-RII, TGF beta Receptor II, TGFBR2, AAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TGFR-2, TGFbeta-RII, TGF-beta receptor type-2

SWISS: P37173

GeneID: 7048

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Most cell types express three sizes of receptors for TGF-beta. These are designated Type I (53 kDa), Type II (70-85 kDa), and Type III (250-350 kDa). The Type III receptor, a proteoglycan that exists in membrane-bound and soluble forms, binds TGF-beta 1, TGF-beta 2, and TGF-beta 3 but does not appear to be involved in signal transduction. The Type II receptor is a membrane-bound serine/threonine kinase that binds TGF-beta 1 and TGF-beta 3 with high affinity and TGF-beta 2 with a much lower affinity. The Type I receptor is also a membrane-bound serine/threonine kinase that apparently requires the presence of the Type II receptor to bind TGF-beta. Current evidence suggests that signal transduction requires the cytoplasmic domains of both the Type I and Type II receptors.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant human TGFB1 at 2 μg/mL (100 μL/well) can bind recombinant human TGFBR2 with a linear range of 1-5 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only