ABclonal
Recombinant Human TGFR-1/ALK-5 Protein - RP01408
Recombinant Human TGFR-1/ALK-5 Protein - RP01408
Couldn't load pickup availability
Recombinant Human TGFR-1/ALK-5 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01408-10, RP01408-20, RP01408-50, RP01408-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TGFR-1/ALK-5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu125) of human TGFBR1/ALK5 (Accession #NP_004603.1) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: TGFBR1, AAT5, ACVRLK4, ALK-5, ALK5, ESS1, LDS1, LDS1A, LDS2A, MSSE, SKR4, TGFR-1, tbetaR-I, TBRI, TBR-i
SWISS: P36897-1
GeneID: 7046
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Transforming growth factor, beta receptor I, also known as Transforming growth factor-beta receptor type I , Serine / threonine-protein kinase receptor R4, Activin receptor-like kinase 5, SKR4, ALK-5, and TGFBR1, is a single-pass type I membrane protein that belongs to the protein kinase superfamily and TGFB receptor subfamily. TGFBR1 / ALK-5 is found in all tissues examined. It is most abundant in placenta and least abundant in brain and heart. TGF-beta functions as a tumor suppressor by inhibiting the cell cycle in the G1 phase. Administration of TGF-beta is able to protect against mammary tumor development in transgenic mouse models in vivo. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers, with the majority of colon and gastric cancers being caused by an inactivating mutation of TGF-beta RII. On ligand binding, TGFBR1 / ALK-5 forms a receptor complex consisting of two type I I and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which auto-phosphorylate, then bind and activate SMAD transcriptional regulators.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TGF-beta Protein at 2 μg/mL (100 μL/well) can bind TGFBR1 with a linear range of 3.9-80.49 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
