Recombinant Human Thrombopoietin/THPO Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00174-10, RP00174-20, RP00174-50, RP00174-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Thrombopoietin/THPO Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Gly353) of human Thrombopoietin/THPO (Accession #NP_000451.1) fused with a 6×His tag at the C-terminus.
Alternate Names: THPO, MGDF, MKCSF, ML, MPLLG, THCYT1, TPO
SWISS: P40225
GeneID: 7066
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Thrombopoietin (TPO or THPO), also known as myeloproliferative leukemia virus ligand (c-Mpl), is a hematopoietic growth factor belonging to the EPO/TPO family. Megakaryocytopoiesis is the cellular development process that leads to platelet production. TPO is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. TPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in TPO gene are the cause of thrombocythemia.
Bio-Activity: 1.Recombinant Human TPO(50 ng/mL) , IL-3(15 ng/mL, Cat. RP01362), IL-6(15 ng/mL, Cat. RP00201) and IL-11(15 ng/mL, Cat. RP00050) induce hematopoietic stem and progenitor cells to differentiate into megakaryocytes. After 6 days, the induction of CD41/42+ megakaryocytes was successful.|2.Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. Avanzi, G. et al. (1988) Br. J. Haematol. 69:359. The ED50 for this effect is 2.61-10.44 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only