Recombinant Human THSD1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00253-10, RP00253-20, RP00253-50, RP00253-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human THSD1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu 25 - Ile 361 ) of human THSD1 (Accession #NP_954872.1) fused with a 6×His tag at the C-terminus.
Alternate Names: THSD1
SWISS: Q9NS62-2
GeneID: 55901
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Human Thrombospondin type-1 domain-containing protein 1 (THSD1) also known as Transmembrane molecule with thrombospondin module (TMTSP), is a single-pass type I membrane protein. In addition, THSD1 is widely expressed on endothelial cells, with highest expression in the lung. THSD1’s ligand and function are unknown, but it is postulated that THSD1 may be involved in the regulation of vasculogenesis and/or angiogenesis through its interaction with its specific ligand.
Bio-Activity: Measured by the ability of the immobilized protein to support the adhesion of SVEC4‑10 mouse vascular endothelial cells. When 5×104 cells/well are added to rhTHSD1 coated plates (30 µg/mL, 100 µL/well), approximately 13-17% will adhere after 60 minutes at
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only