ABclonal
Recombinant Human Thy-1/CD90 Protein - RP01965
Recombinant Human Thy-1/CD90 Protein - RP01965
Couldn't load pickup availability
Recombinant Human Thy-1/CD90 Protein
Sizes: 50ug, 100ug
Catalogue Number: RP01965-50, RP01965-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Thy-1/CD90 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln20-Cys130) of Human Thy-1/CD90 (Accession #NP_001298089.1) fused with a His tag at the N-terminus.
Alternate Names: THY1, Thy-1 membrane glycoprotein, CDw90, Thy-1 antigen, CD90
SWISS: P04216
GeneID: 7070
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CD90, also known as Thy1, is an approximately 25-35 kDa glycoprotein that mediates cellular adhesion and exerts wide ranging effects in different tissues. CD90 is expressed on hematopoietic progenitor cells, neurons, and activated vascular endothelial cells. Its species-specific expression in lymphoid cells allows its use as a thymocyte and pan T cell marker in mouse but not in human. CD90 can form dimers and higher order multimers. It binds to heparin, the proteoglycan Syndecan-4, and Integrins alpha M beta 2, alpha V beta 3, and alpha V beta 5. Through these interactions, CD90 inhibits neurite outgrowth, promotes astrocyte adhesion, mediates the adhesion and extravasation of leukocytes and melanoma cells, supports the Thrombospondin-1 induced disassembly of fibroblast focal adhesions, and inhibits the activation of latent TGF-beta 1, myofibroblast differentiation, and lung fibrosis. Human Thy-1 shares 63% and 66% amino acids similarity with mouse and rat homolog.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
