Skip to product information
1 of 1

ABclonal

Recombinant Human Thy-1/CD90 Protein - RP03226

Recombinant Human Thy-1/CD90 Protein - RP03226

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Thy-1/CD90 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP03226-10, RP03226-20, RP03226-50, RP03226-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Thy-1/CD90 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln20-Cys130) of Human Thy-1/CD90 (Accession #NP_001298089.1) fused with hFc tag at the N-terminus.

Alternate Names: THY1, Thy-1 membrane glycoprotein, CDw90, Thy-1 antigen, CD90

SWISS: P04216

GeneID: 7070

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD90, also known as Thy1, is an approximately 25-35 kDa glycoprotein that mediates cellular adhesion and exerts wide ranging effects in different tissues. CD90 is expressed on hematopoietic progenitor cells, neurons, and activated vascular endothelial cells. Its species-specific expression in lymphoid cells allows its use as a thymocyte and pan T cell marker in mouse but not in human. CD90 can form dimers and higher order multimers. It binds to heparin, the proteoglycan Syndecan-4, and Integrins alpha M beta 2, alpha V beta 3, and alpha V beta 5. Through these interactions, CD90 inhibits neurite outgrowth, promotes astrocyte adhesion, mediates the adhesion and extravasation of leukocytes and melanoma cells, supports the Thrombospondin-1 induced disassembly of fibroblast focal adhesions, and inhibits the activation of latent TGF-beta 1, myofibroblast differentiation, and lung fibrosis. Human Thy-1 shares 63% and 66% amino acids similarity with mouse and rat homolog.

Source: HEK293 cells

Tag: N-hFC

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details