WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human TIMP-1 Protein - RP01341

Recombinant Human TIMP-1 Protein - RP01341

Regular price
$168.00
Regular price
Sale price
$168.00
Unit price
per 
Availability
Sold out

Recombinant Human TIMP-1 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP01341-10, RP01341-20, RP01341-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TIMP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Ala207) of human TIMP-1/CLGI (Accession #NP_003245.1) fused with 6×His tag at the C-terminus.

Alternate Names: CLGI, EPA, EPO, HCI, TIMP, TIMP-1, TIMP1, EPA, EPO, HCI, TIMP, TIMP-1

SWISS: P01033

GeneID: 7076

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: TIMP metallopeptidase inhibitor 1, also known as TIMP-1/TIMP1, Collagenase inhibitor 16C8 fibroblast Erythroid-potentiating activity, TPA-S1TPA-induced proteinTissue inhibitor of metalloproteinases 1, is a natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. TIMP-1/TIMP1 is found in fetal and adult tissues. Highest levels are found in bone, lung, ovary and uterus. Complexes with metalloproteinases and irreversibly inactivates them by binding to their catalytic zinc cofactor. TIMP-1/TIMP1 mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. In addition to its inhibitory role against most of the known MMPs, the protein is able to promote cell proliferation in a wide range of cell types, and may also have an anti-apoptotic function. Transcription of this protein encoding gene is highly inducible in response to many cytokines and hormones. In addition, the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This encoding gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction. Complexes with metalloproteinases and irreversibly inactivates them by binding to their catalytic zinc cofactor. TIMP-1/TIMP1 is Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13 and MMP-16.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human TIMP1 Protein at 1 μg/mL (100 μL/well) can bind TIMP1 Rabbit mAb with a linear range of 0.038-2.5 ng/mL.|2.Measured by its ability to inhibit human MMP-2 cleavage of a fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The IC50 value is approximately 2.2 nM.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only