Skip to product information
1 of 1

ABclonal

Recombinant Human TIMP-2 Protein - RP01370

Recombinant Human TIMP-2 Protein - RP01370

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TIMP-2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01370-10, RP01370-20, RP01370-50, RP01370-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TIMP-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys27-Pro220) of human TIMP2/CSC-21K (Accession #NP_003246.1.) fused with a 6×His tag at the C-terminus.

Alternate Names: TIMP2, CSC-21K, DDC8

SWISS: P16035

GeneID: 7077

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Tissue inhibitors of metalloproteinases (TIMP) family are natural inhibitors of the matrix metalloproteinases (MMPs), the zinc enzymes involved in extracellular matrix maintenance and remodeling. The TIMP family encompasses four members (TIMP1-4), and they inhibit most MMPs by forming non-covalent binary complex. TIMP2 is a 22 kDa non N-glycosylated protein expressed by a variety of cell types, and plays a unique role among TIMP family members owing to its functions to regulate cellular responses to growth factors. Findings establish an unexpected, MMP-independent mechanism for TIMP2 inhibition of endothelial cell proliferation in vitro and reveal an important component of the antiangiogenic effect of TIMP2 in vivo. TIMP-2 thus is critical to the maintenance of tissue homeostasis and is involved in the regulation of tumor microenvironment.

Bio-Activity: 1.Measured by its ability to inhibit human MMP-2 cleavage of a fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The IC50 value is approximately 2.5 nM.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details