Recombinant Human TIMP-2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01370-10, RP01370-20, RP01370-50, RP01370-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TIMP-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys27-Pro220) of human TIMP2/CSC-21K (Accession #NP_003246.1.) fused with a 6×His tag at the C-terminus.
Alternate Names: TIMP2, CSC-21K, DDC8
SWISS: P16035
GeneID: 7077
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Tissue inhibitors of metalloproteinases (TIMP) family are natural inhibitors of the matrix metalloproteinases (MMPs), the zinc enzymes involved in extracellular matrix maintenance and remodeling. The TIMP family encompasses four members (TIMP1-4), and they inhibit most MMPs by forming non-covalent binary complex. TIMP2 is a 22 kDa non N-glycosylated protein expressed by a variety of cell types, and plays a unique role among TIMP family members owing to its functions to regulate cellular responses to growth factors. Findings establish an unexpected, MMP-independent mechanism for TIMP2 inhibition of endothelial cell proliferation in vitro and reveal an important component of the antiangiogenic effect of TIMP2 in vivo. TIMP-2 thus is critical to the maintenance of tissue homeostasis and is involved in the regulation of tumor microenvironment.
Bio-Activity: 1.Measured by its ability to inhibit human MMP-2 cleavage of a fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The IC50 value is approximately 2.5 nM.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only