Recombinant Human TL1A protein(N-His)(active)
Size: 100μg
Catalogue Number: PKSH034127-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: TL1A
Target Symptom: TNFSF15; VEGI
Target Species: Human
Expression Host: E.coli
Application: Cell culture
Fusion Tag: C-His
UNIProt ID: O95150
Accession: O95150
Background: TL-1A belongs to the TNF superfamily of ligands. It is specially expressed in endothelial cells, and is detected in the placenta, lung, kidney skeletal muscle, pancreas, small intestine and colon. TL-1A inhibits endothelial cell proliferation and angiogenesis. It has been proved to promote NF-KB activation, caspase activity, and apoptosis in responding cell lines. TL-1Acan bind with TNFRSF25/DR3 receptor and a decoy receptor TNFRSF21/DR6.
Activity: Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is < 0.2 ng/mL.
Sequence: QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 8.0
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 22 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only