Recombinant Human TMIGD2/CD28H Protein
Sizes: 10ug, 50ug
Catalogue Number: RP00809-10, RP00809-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TMIGD2/CD28H Protein is produced by Human cells expression system. The target protein is expressed with sequence (Leu23-Gly150) of human TMIGD2/IGPR1 (Accession #Q96BF3) fused with a 6×His tag at the C-terminus.
Alternate Names: Transmembrane and immunoglobulin domain-containing protein 2, Immunoglobulin and proline-rich receptor 1, IGPR1, TMIGD2
SWISS: Q96BF3
GeneID: 126259
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: TMIGD2 is a single-pass type I membrane protein, which contains one Ig-like (immunoglobulin-like) domain. Itis widely expressed in many tissues, such as epithelial, endothelial cells and lung. However, it isn’t detected inthyroid, cerebellum, thymus and cerebral cortex. TMIGD2 can form homophilic interactions that could regulatecell-cell interaction. It Interacts with CACNB2, DST, MIA and NCKIPSD. It is shown that TMIGD2 plays a role incell-cell interaction, cell migration, and angiogenesis.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only