ABclonal
Recombinant Human TMPO Protein - RP02141
Recombinant Human TMPO Protein - RP02141
Couldn't load pickup availability
Recombinant Human TMPO Protein
Sizes: 10ug, 50ug
Catalogue Number: RP02141-10, RP02141-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TMPO Protein is produced by E.coli expression system. The target protein is expressed with sequence (Pro2-Glu187) of human TMPO (Accession #P42167) fused with a 6xHis tag at the C- terminus.
Alternate Names: TMPO, CMD1T, LAP2, LEMD4, PRO0868, TP, thymopoietin, CMD1T, LAP2, LEMD4, PRO0868, TP
SWISS: P42166
GeneID: 7112
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Thymopentin is a member of the LEM family. Thymopentin is expressed in many tissues, highly in the adult thymus and fetal liver. The N-terminal contains two structurally independent domains, LEM domain and LEM-like domain. The C-terminal domain forms a four-stranded coiled coil. Thymopentin may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It is associated with T-cell development and function. Meantime, Thymopentin plays an important role, together with LMNA, in the nuclear anchorage of RB1. Thymopoietin is participated in the induction of CD90 in the thymus.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
