Skip to product information
1 of 1

ABclonal

Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein - RP00805

Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein - RP00805

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP00805-10, RP00805-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala26-Ala221) of human TNFRSF10C/DcR1/TRAIL-R3/CD263 (Accession #O14798) fused with a 6×His tag at the C-terminus.

Alternate Names: TNFRSF10C, CD263, DCR1, DCR1-TNFR, LIT, TRAIL-R3, TRAILR3, TRID

SWISS: O14798

GeneID: 8794

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) is a glycosyl-phosphatidylinositol-linked membraneprotein which binds TRAIL with high affinity. TNFRSF10C has the TRAIL-binding extracellular cysteine-rich domains, lacks theintracellular signaling domain. As a result, binding of TRAIL to TRAIL R3 doesn ’ t transduce an apoptosis signal. Theexpression of TRAIL R3 gene has been shown to protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL-inducedapoptosis.

Source: HEK293 cells

Tag: C-6×His

Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.Contact us for customized product form or formulation.

Antigen Sequence: ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details