WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human TNFRSF11B/Osteoprotegerin Protein - RP00180

Recombinant Human TNFRSF11B/Osteoprotegerin Protein - RP00180

Regular price
$168.00
Regular price
Sale price
$168.00
Unit price
per 
Availability
Sold out

Recombinant Human TNFRSF11B/Osteoprotegerin Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00180-10, RP00180-20, RP00180-50, RP00180-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFRSF11B/Osteoprotegerin Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu22-Leu401) of human Osteoprotegerin/TNFRSF11B (Accession #NP_002537.3) fused with a 6×His tag at the C-terminus.

Alternate Names: TNFRSF11B, OCIF, OPG, PDB5, TR1, TNF receptor superfamily member 11b, Osteoprotegerin, OCIF, OPG, PDB5, TR1

SWISS: O00300

GeneID: 4982

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Osteoprotegerin or TNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant human TNFRSF11B at 2 μg/mL (100 μL/well) can bind Recombinant human TNFSF11 with a linear range of 2-8 ng/mL.|2.Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 28.5-114 pg/mL in the presence of 20 ng/mL Recombinant Human TRAIL/TNFSF10.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only