Recombinant Human TNFRSF1A/TNF-R1/CD120a Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01347-10, RP01347-20, RP01347-50, RP01347-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFRSF1A/TNF-R1/CD120a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Thr211) of human CD120a/TNFRSF1A (Accession #NP_001056.1) fused with 6×His tag at the C-terminus.
Alternate Names: TNFRSF1A, CD120a, FPF, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60
SWISS: P19438-1
GeneID: 7132
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. CD120a (cluste of differentiation 120a), also known as TNFR1 / TNFRSF1A, is a member of CD family, tumor necrosis factor receptor superfamily. CD120a is one of the most primary receptors for the tumor necrosis factor-alpha. It has been shown to be localized to both plasma membrane lipid rafts and the trans golgi complex with the help of the death domain (DD). CD120a can activate the transcription factor NF-κB, mediate apoptosis, and regulate inflammation processes.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF1A at 2 μg/mL (100 μL/well) can bind Mouse TNFα with a linear range of 4-135 ng/mL.|2.Measured by its ability to inhibit TNFα-mediated cytotoxicity in the L929 mouse fibrosarcoma cells in the presence of metabolic inhibitor actinomycin D. The ED50 for this effect is typically 22-88ng/mL in the presence of 0.25 ng/mL recombinant human TNFα.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDC RECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLF QCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN VKGTEDSGTT
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only