Skip to product information
1 of 1

ABclonal

Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein - RP00252

Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein - RP00252

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein

Sizes: 20ug, 100ug

Catalogue Number: RP00252-20, RP00252-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu 23 - Asp 257) of human TNFR2 (Accession #NP_001057.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CD120b, TBPII, TNF-R-II, TNF-R75, TNFBR, TNFR1B, TNFR2, TNFR80, p75, p75TNFR, TNF Receptor II, TNFRSF1B

SWISS: P20333

GeneID: 7133

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its ability to inhibit TNF-α mediated cytotoxicity in L-929 mouse fibrosarcoma cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is typically 1-3 μg/mL in the presence of 0.25 ng/mL recombinant human TNF-α.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details