ABclonal
Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein - RP00252
Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein - RP00252
Couldn't load pickup availability
Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein
Sizes: 20ug, 100ug
Catalogue Number: RP00252-20, RP00252-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu 23 - Asp 257) of human TNFR2 (Accession #NP_001057.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CD120b, TBPII, TNF-R-II, TNF-R75, TNFBR, TNFR1B, TNFR2, TNFR80, p75, p75TNFR, TNF Receptor II, TNFRSF1B
SWISS: P20333
GeneID: 7133
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its ability to inhibit TNF-α mediated cytotoxicity in L-929 mouse fibrosarcoma cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is typically 1-3 μg/mL in the presence of 0.25 ng/mL recombinant human TNF-α.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
