ABclonal
Recombinant Human TNFRSF4/OX40/CD134 Protein - RP01357
Recombinant Human TNFRSF4/OX40/CD134 Protein - RP01357
Couldn't load pickup availability
Recombinant Human TNFRSF4/OX40/CD134 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01357-10, RP01357-20, RP01357-50, RP01357-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFRSF4/OX40/CD134 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Ala216) of human OX40/TNFRSF4/CD134 (Accession #NP_003318.1) fused with a 6×His tag at the C-terminus.
Alternate Names: TNFRSF4, ACT35, CD134, IMD16, OX40, TXGP1L
SWISS: P43489
GeneID: 7293
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: OX40 (CD134) and its binding partner, OX40L (CD252), are members of the tumor necrosis factor receptor/tumor necrosis factor superfamily, is known to break an existing state of tolerance in malignancies, leading to a reactivation of antitumor immunity. The interaction between OX40 and OX40L plays an important role in antigen-specific T-cell expansion and survival. OX40 and OX40L also regulate cytokine production from T cells, antigen-presenting cells, natural killer cells, and natural killer T cells, and modulate cytokine receptor signaling. In line with these important modulatory functions, OX40-OX40L interactions have been found to play a central role in the development of multiple inflammatory and autoimmune diseases, making them attractive candidates for intervention in the clinic. Conversely, stimulating OX40 has shown it to be a candidate for therapeutic immunization strategies for cancer and infectious disease.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human OX40 at 2 μg/mL (100 μL/well) can bind Human OX40 Ligand/TNFSF4 Protein with a linear range of 156.25-872.87 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Endotoxin: Please contact us for more information.
Research Use Only
