ABclonal
Recombinant Human TNFRSF5/CD40 Protein - RP01218
Recombinant Human TNFRSF5/CD40 Protein - RP01218
Couldn't load pickup availability
Recombinant Human TNFRSF5/CD40 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01218-10, RP01218-20, RP01218-50, RP01218-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFRSF5/CD40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu21-Arg193) of human CD40/TNFRSF5 (Accession #NP_001241.1) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: CD40, Bp50, CDW40, TNFRSF5, p50, Bp50, CDW40, TNFRSF5
SWISS: P25942-1
GeneID: 958
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CD40 Ligand at 2 μg/mL (100 μL/well) can bind Recombinant Human CD40 with a linear range of 224-898 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
