Skip to product information
1 of 1

ABclonal

Recombinant Human TNFRSF5/CD40 Protein - RP01218

Recombinant Human TNFRSF5/CD40 Protein - RP01218

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TNFRSF5/CD40 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01218-10, RP01218-20, RP01218-50, RP01218-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFRSF5/CD40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu21-Arg193) of human CD40/TNFRSF5 (Accession #NP_001241.1) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: CD40, Bp50, CDW40, TNFRSF5, p50, Bp50, CDW40, TNFRSF5

SWISS: P25942-1

GeneID: 958

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CD40 Ligand at 2 μg/mL (100 μL/well) can bind Recombinant Human CD40 with a linear range of 224-898 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details