ABclonal
Recombinant Human TNFRSF9/4-1BB/CD137 Protein - RP00276
Recombinant Human TNFRSF9/4-1BB/CD137 Protein - RP00276
Couldn't load pickup availability
Recombinant Human TNFRSF9/4-1BB/CD137 Protein
Sizes: 50ug, 100ug
Catalogue Number: RP00276-50, RP00276-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFRSF9/4-1BB/CD137 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu 24 - Gln 186) of human 4-1BB/CD137 (Accession #NP_001552) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: TNFRSF9, 4-1BB, CD137, CDw137, ILA
SWISS: Q07011-1
GeneID: 3604
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF9 at 2 μg/mL (100 μL/well) can bind Human TNFRSF9 with a linear range of 0.1-12.9 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
