Recombinant Human TNFRSF9/4-1BB/CD137 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01698-10, RP01698-20, RP01698-50, RP01698-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Leukemia inhibitory factor/LIF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu24-Gln186) of human TNFRSF9/4-1BB/CD137 (Accession #NP_002300.1) fused with a 6×His tag at the C-terminus.
Alternate Names: ILA; 4-1BB; CD137; CDw137; TNFRSF9
SWISS: Q07011
GeneID: 3604
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CD137 (also known as 4-1BB) is a surface co-stimulatory glycoprotein originally described as present on activated T lymphocytes, which belongs to the tumor necrosis factor (TNF) receptor superfamily. It is expressed mainly on activated CD4+ and CD8+ T cells, and binds to a high-affinity ligand (4-1BBL) expressed on several antigen-presenting cells such as macrophages and activated B cells. Upon ligand binding, 4-1BB is associated with the tumor necrosis factor receptor–associated factors (TRAFs), the adaptor protein which mediates downstream signaling events including the activation of NF-kappaB and cytokine production. 4-1BB signaling either by binding to 4-1BBL or by antibody ligation delivers signals for T-cell activation and growth, as well as monocyte proliferation and B-cell survival, and plays an important role in the amplification of T cell-mediated immune responses.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF9 (Catalog: RP01698) at 2 μg/mL (100 μL/well) can bind Human TNFSF9 (Catalog: RP00060) with a linear range of 1-4.4 ng/mL.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only