Skip to product information
1 of 1

ABclonal

Recombinant Human TNFSF11/RANKL/CD254 Protein - RP00183

Recombinant Human TNFSF11/RANKL/CD254 Protein - RP00183

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TNFSF11/RANKL/CD254 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00183-10, RP00183-20, RP00183-50, RP00183-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFSF11/RANKL/CD254 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly136-Asp317) of human TRANCE/RANK L/TNFSF11 (Accession #NP_143026.1) fused with a 6×His tag at the N-terminus.

Alternate Names: TNFSF11, CD254, ODF, OPGL, OPTB2, RANKL, TNLG6B, TRANCE, hRANKL2, sOdf

SWISS: O14788

GeneID: 8600

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Tumor necrosis factor ligand superfamily member 11, also known as Receptor activator of nuclear factor kappa-B ligand, Osteoprotegerin ligand, TNFSF11, RANKL, TRANCE, OPGL and CD254, is a single-pass type II membrane protein which belongs to the tumor necrosis factor family. TNFSF11 is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. TNFSF11 was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF11 Protein at 2 μg/mL (100 μL/well) can bind Mouse TNFRSF11B with a linear range of 0.049-13.74 ng/mL.|2.Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 10.85-43.42 ng/mL, corresponding to a specific activity of 2.30×104~9.22×104 units/mg.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details