Skip to product information
1 of 1

ABclonal

Recombinant Human TNFSF12/TWEAK Protein - RP01446

Recombinant Human TNFSF12/TWEAK Protein - RP01446

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TNFSF12/TWEAK Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01446-10, RP01446-20, RP01446-50, RP01446-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFSF12/TWEAK Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys97-His249 (N-Met)) of human TWEAK/TNFSF12 (Accession #NP_003800.1) fused with no additional amino acid.

Alternate Names: TNFSF12, APO3L, DR3LG, TNLG4A, TWEAK

SWISS: O43508-1

GeneID: 8742

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: TNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. It is a ligand for the FN14/TWEAKR receptor. TNFSF12 has overlapping signaling functions with TNF, but displays a much wider tissue distribution. It can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. It is also found that TNFSF12 promotes proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. TNFSF12 also is a weak inducer of apoptosis in some cell types and mediates NF-kappa-B activation.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF12 at 2 μg/mL (100 μL/well) can bind Human TNFRSF12A with a linear range of 0.1-2.3 ng/mL.|2.Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC). The ED50 for this effect is typically 0.81-3.24 ng/mL.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: KGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details